TNFRSF10B (Human) Recombinant Protein Ver mas grande

Human TNFRSF10B (O14763, 56 a.a. - 210 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expre

AB-P8039

Producto nuevo

TNFRSF10B (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 50 ug
Gene Name TNFRSF10B
Gene Alias CD262|DR5|KILLER|KILLER/DR5|TRAIL-R2|TRAILR2|TRICK2|TRICK2A|TRICK2B|TRICKB|ZTNFR9
Gene Description tumor necrosis factor receptor superfamily, member 10b
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKESGTKHSGEVPAVEETVTS
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In Phosphate-Buffer Saline pH 7.4 (10% glycerol)
Gene ID 8795

Más información

Human TNFRSF10B (O14763, 56 a.a. - 210 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expression system.

Consulta sobre un producto

Human TNFRSF10B (O14763, 56 a.a. - 210 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expre

Human TNFRSF10B (O14763, 56 a.a. - 210 a.a.) partial length recombinant protein with hIgG-His tag expressed in Baculovirus expre