Ver mas grande
Ak1 (Mouse) Recombinant Protein
AB-P8031
Producto nuevo
Ak1 (Mouse) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Ak1 |
| Gene Alias | Ak-1|B430205N08Rik |
| Gene Description | adenylate kinase 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGCCVSSEPQEEGGRKTGEKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFSEVCTYLDSLK |
| Form | Liquid |
| Antigen species Target species | Escherichia coli |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In 20mM Tris-HCl pH 8.0 (10% glycerol, 1 mM DTT) |
| Gene ID | 11636 |
Más información
Mouse Ak1 (Q9R0Y5, 1 a.a. - 210 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.