ECHS1 (Human) Recombinant Protein Ver mas grande

ECHS1 (Human) Recombinant Protein

AB-P8016

Producto nuevo

ECHS1 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 100 ug
Gene Name ECHS1
Gene Alias SCEH
Gene Description enoyl Coenzyme A hydratase, short chain, 1, mitochondrial
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq ASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEK
Form Liquid
Quality control testing 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20mM Tris-HCl pH 8.0 (20% glycerol, 100 mM NaCl, 1 mM DTT)
Gene ID 1892

Más información

Human ECHS1 (P30084, 28 a.a. - 290 a.a.) partial length recombinant protein with His tag expressed in Escherichia coli.

Consulta sobre un producto

ECHS1 (Human) Recombinant Protein

ECHS1 (Human) Recombinant Protein