Ver mas grande
Human ECHS1 (P30084, 28 a.a. - 290 a.a.) partial length recombinant protein with His tag expressed in iEscherichia coli/i.
AB-P8016
Producto nuevo
ECHS1 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | ECHS1 |
| Gene Alias | SCEH |
| Gene Description | enoyl Coenzyme A hydratase, short chain, 1, mitochondrial |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | ASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEK |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In 20mM Tris-HCl pH 8.0 (20% glycerol, 100 mM NaCl, 1 mM DTT) |
| Gene ID | 1892 |
Más información
Human ECHS1 (P30084, 28 a.a. - 290 a.a.) partial length recombinant protein with His tag expressed in Escherichia coli.