Ver mas grande
PHPT1 (Human) Recombinant Protein
AB-P8010
Producto nuevo
PHPT1 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | PHPT1 |
| Gene Alias | CGI-202|DKFZp564M173|HSPC141|PHP14|bA216L13.10 |
| Gene Description | phosphohistidine phosphatase 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY |
| Form | Liquid |
| Quality control testing | 3 ug by SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In 20mM Tris-HCl pH 8.0 (10% glycerol, 0.2 M NaCl, 2 mM DTT) |
| Gene ID | 29085 |
Más información
Human PHPT1 (Q9NRX4, 1 a.a. - 125 a.a.) full length recombinant protein with His tag expressed in Escherichia coli.