Ver mas grande
Trimeric Spike (S) (SARS-CoV-2) Recombinant Protein
AB-P7923
Producto nuevo
Trimeric Spike (S) (SARS-CoV-2) Recombinant Protein
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 ug |
| Storage Conditions | Store at -80ºC.<br>Avoid repeated freeze/thaw cycles. |
| Application Key | ELISA,SDS-PAGE |
| Immunogen Prot. Seq | SQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYV |
| Form | Liquid |
| Recomended Dilution | Enzyme-linked Immunoabsorbent Assay<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In PBS, pH7.4. |
Más información
Trimeric Spike (S) partial recombinant protein with polyhistidine tag at C-terminus expressed in HEK293 cells.