Il3ra (Mouse) Recombinant Protein Ver mas grande

Il3ra (Mouse) Recombinant Protein

AB-P7918

Producto nuevo

Il3ra (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 50 ug
Gene Name Il3ra
Gene Alias CD123|CDw123|SUT-1
Gene Description interleukin 3 receptor, alpha chain
Storage Conditions Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQV
Form Liquid
Recomended Dilution Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Mouse
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In 20mM Tris-HCl buffer, 0.1M NaCl, pH 8.0 (30% glycerol)
Gene ID 16188

Más información

Mouse Il3ra (P26952, 17 a.a. - 331 a.a.) partial recombinant protein with hIgG-His tag expressed in Baculovirus.

Consulta sobre un producto

Il3ra (Mouse) Recombinant Protein

Il3ra (Mouse) Recombinant Protein