FOLH1 (Human) Recombinant Protein Ver mas grande

Human FOLH1 (Q04609, 44 a.a. - 750 a.a.) partial recombinant protein with His tag expressed in Baculovirus.

AB-P7883

Producto nuevo

FOLH1 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 22 Biopuntos. Su cesta contiene un total 22 Biopuntos puede ser convertido en un Biobonos Descuento 88.00EUR.


Hoja técnica

Size 500 ug
Gene Name FOLH1
Gene Alias FGCP|FOLH|GCP2|GCPII|NAALAD1|NAALAdase|PSM|PSMA|mGCP
Gene Description folate hydrolase (prostate-specific membrane antigen) 1
Storage Conditions Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIG
Form Liquid
Recomended Dilution SDS-PAGE<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing SDS-PAGE Stained with Coomassie Blue.
Storage Buffer In PBS, pH 7.4 ( 20% glycerol)
Gene ID 2346

Más información

Human FOLH1 (Q04609, 44 a.a. - 750 a.a.) partial recombinant protein with His tag expressed in Baculovirus.

Consulta sobre un producto

Human FOLH1 (Q04609, 44 a.a. - 750 a.a.) partial recombinant protein with His tag expressed in Baculovirus.

Human FOLH1 (Q04609, 44 a.a. - 750 a.a.) partial recombinant protein with His tag expressed in Baculovirus.