Ver mas grande
CSNK2B (Human) Recombinant Protein
AB-P7877
Producto nuevo
CSNK2B (Human) Recombinant Protein
Comprando este producto generará 17 Biopuntos. Su cesta contiene un total 17 Biopuntos puede ser convertido en un Biobonos Descuento 68.00EUR.
Hoja técnica
| Size | 500 ug |
| Gene Name | CSNK2B |
| Gene Alias | CK2B|CK2N|CSK2B|G5A|MGC138222|MGC138224 |
| Gene Description | casein kinase 2, beta polypeptide |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In 20mM Tris-HCl buffer, 0.15M NaCl, pH 8.0 (10% glycerol, 1mM DTT, 1mM EDTA) |
| Gene ID | 1460 |
Más información
Human CSNK2B (P67870, 1 a.a. - 215 a.a.) full-length recombinant protein expressed in Escherichia coli.