Ver mas grande
Human PGLYRP1 (O75594, 22 a.a. - 196 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.
AB-P7866
Producto nuevo
PGLYRP1 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | PGLYRP1 |
| Gene Alias | MGC126894|MGC126896|PGLYRP|PGRP|PGRP-S|PGRPS|TAG7|TNFSF3L |
| Gene Description | peptidoglycan recognition protein 1 |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In PBS, pH 7.4 (10% glycerol) |
| Gene ID | 8993 |
Más información
Human PGLYRP1 (O75594, 22 a.a. - 196 a.a.) partial recombinant protein with His tag expressed in HEK293 cells.