Ver mas grande
Mouse Thbs4 (Q9Z1T2, 27 a.a. - 963 a.a.) partial recombinant protein expressed in HEK293 cells.
AB-P7865
Producto nuevo
Thbs4 (Mouse) Recombinant Protein
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | Thbs4 |
| Gene Alias | TSP-4|TSP4 |
| Gene Description | thrombospondin 4 |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | QATPQVFDLLPSSSQRLNPSALQPVLTDPTLHEVYLISTFKLQSKSSATIFGLYSSSDNSKYFEFTVMGRLNKAILRYLKNDGKIHLVVFNNLQLADGRRHRVLLRLSNLQRGDGSVELYLDCAQADSVRNLPRAFSGLTQNPESIELRTFQRKPQDFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATSTGDFNRQFLGQMTQLNQLLGEVKDLLRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLVPIAP |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Mouse |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In PBS, 0.1mM PMSF, pH 7.4 (20% glycerol) |
| Gene ID | 21828 |
Más información
Mouse Thbs4 (Q9Z1T2, 27 a.a. - 963 a.a.) partial recombinant protein expressed in HEK293 cells.