Ver mas grande
Human SEPW1 (P63302, 1 a.a. - 87 a.a.) full-length recombinant protein with His tag expressed in iEscherichia coli/i.
AB-P7863
Producto nuevo
SEPW1 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | SEPW1 |
| Gene Alias | selW |
| Gene Description | selenoprotein W, 1 |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MALAVRVVYCGACGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQG |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | In 20mM Tris-HCl buffer, 0.15M NaCl, pH 8.0 (20% glycerol, 1mM DTT) |
| Gene ID | 6415 |
Más información
Human SEPW1 (P63302, 1 a.a. - 87 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.