Ver mas grande
ENTPD3 (Human) Recombinant Protein
AB-P7790
Producto nuevo
ENTPD3 (Human) Recombinant Protein
No hay Biopuntos para este producto
Hoja técnica
| Size | 50 ug |
| Gene Name | ENTPD3 |
| Gene Alias | CD39L3|FLJ93839|HB6|NTPDase-3 |
| Gene Description | ectonucleoside triphosphate diphosphohydrolase 3 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSQIHKQEVLPPGLKYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAML |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE<br>Denatured<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. |
| Storage Buffer | In 20mM Tris-HCl buffer, pH8.0 (10% glycerol). |
| Gene ID | 956 |
Más información
Human ENTPD3 (NP_001239.2, 44 a.a. - 485 a.a ) partial recombinant protein with His tag expressed in Escherichia coli.