POLR2K (Human) Recombinant Protein
  • POLR2K (Human) Recombinant Protein

POLR2K (Human) Recombinant Protein

Ref: AB-P7742
POLR2K (Human) Recombinant Protein

Información del producto

Human POLR2K (NP_005025, 1 a.a. - 58 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 250 ug
Gene Name POLR2K
Gene Alias ABC10-alpha|RPABC4|RPB10alpha|RPB12|RPB7.0|hRPB7.0|hsRPB10a
Gene Description polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
Form Liquid
Recomended Dilution SDS-PAGE
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Storage Buffer In PBS, pH 7.4 (1 mM DTT, 10% glycerol).
Gene ID 5440

Enviar un mensaje


POLR2K (Human) Recombinant Protein

POLR2K (Human) Recombinant Protein