AB-P7726
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 8 Biopuntos. Su cesta contiene un total 8 Biopuntos puede ser convertido en un Biobonos Descuento 32.00EUR.
Size | 500 ug |
Gene Name | BRD2 |
Gene Alias | D6S113E|DKFZp686N0336|FLJ31942|FSH|FSRG1|KIAA9001|NAT|RING3|RNF3 |
Gene Description | bromodomain containing 2 |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Concentration | 1mg/mL |
Application Key | SDS-PAGE |
Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPANPPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPE |
Form | Liquid |
Recomended Dilution | SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Quality control testing | 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. |
Storage Buffer | In PBS, pH 7.4 (1 mM DTT, 10% glycerol). |
Gene ID | 6046 |