Ver mas grande
ELP4 (Human) Recombinant Protein
AB-P7697
Producto nuevo
ELP4 (Human) Recombinant Protein
Comprando este producto generará 8 Biopuntos. Su cesta contiene un total 8 Biopuntos puede ser convertido en un Biobonos Descuento 32.00EUR.
Hoja técnica
| Size | 500 ug |
| Gene Name | ELP4 |
| Gene Alias | C11orf19|FLJ20498|PAX6NEB|PAXNEB|dJ68P15A.1 |
| Gene Description | elongation protein 4 homolog (S. cerevisiae) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTVLLIEEDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRFGHYYDASKRMPQELIEASNWHGFFLPEKISSTLKVEPCSLTPGYTKLLQFIQ |
| Form | Liquid |
| Recomended Dilution | SDS-PAGE<br>Denatured<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain. |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol). |
| Gene ID | 26610 |
Más información
Human ELP4 (NP_061913, 1 a.a. - 424 a.a ) full-length recombinant protein with His tag expressed in Escherichia coli.