Ver mas grande
Human PTPN11 (Q8WXI7, 31 a.a. - 150 a.a.) partial recombinant protein with His tag at C-terminus expressed in Human cells.
AB-P7659
Producto nuevo
PTPN11 (Human) Recombinant Protein
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | PTPN11 |
| Gene Alias | BPTP3|CFC|MGC14433|NS1|PTP-1D|PTP2C|SH-PTP2|SH-PTP3|SHP2 |
| Gene Description | protein tyrosine phosphatase, non-receptor type 11 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINL |
| Form | Lyophilized |
| Quality control testing | SDS-PAGE under reducing condition |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 5781 |
Más información
Human PTPN11 (Q8WXI7, 31 a.a. - 150 a.a.) partial recombinant protein with His tag at C-terminus expressed in Human cells.