SLAMF7 (Human) Recombinant Protein Ver mas grande

SLAMF7 (Human) Recombinant Protein

AB-P7657

Producto nuevo

SLAMF7 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 100 ug
Gene Name SLAMF7
Gene Alias 19A|CD319|CRACC|CS1
Gene Description SLAM family member 7
Storage Conditions Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM
Form Lyophilized
Quality control testing SDS-PAGE under reducing condition
Storage Buffer Lyophilized from sterile distilled Water up to 100 ug/mL
Gene ID 57823

Más información

Human SLAMF7 (Q9NQ25, 23 a.a. - 226 a.a.) partial recombinant protein with His-Avi tag at C-terminus expressed in Expi293 cells.

Consulta sobre un producto

SLAMF7 (Human) Recombinant Protein

SLAMF7 (Human) Recombinant Protein