Ver mas grande
Human MS4A1 (P11836, 141 a.a. - 188 a.a.) partial recombinant protein with His-Avi tag at C-terminus expressed in iEscherichia c
AB-P7647
Producto nuevo
MS4A1 (Human) Recombinant Protein
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | MS4A1 |
| Gene Alias | B1|Bp35|CD20|LEU-16|MGC3969|MS4A2|S7 |
| Gene Description | membrane-spanning 4-domains, subfamily A, member 1 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQS |
| Form | Liquid |
| Quality control testing | SDS-PAGE under reducing condition |
| Storage Buffer | In PB solution, pH 7.0 (10% glycerol) |
| Gene ID | 931 |
Más información
Human MS4A1 (P11836, 141 a.a. - 188 a.a.) partial recombinant protein with His-Avi tag at C-terminus expressed in Escherichia coli.