Ver mas grande
Human NT5E (P21589, 27 a.a. - 547 a.a.) partial recombinant protein with His tag at C-terminus expressed in Expi293 cells.
AB-P7646
Producto nuevo
NT5E (Human) Recombinant Protein
Comprando este producto generará 40 Biopuntos. Su cesta contiene un total 40 Biopuntos puede ser convertido en un Biobonos Descuento 160.00EUR.
Hoja técnica
| Size | 1 mg |
| Gene Name | NT5E |
| Gene Alias | CD73|E5NT|NT|NT5|NTE|eN|eNT |
| Gene Description | 5'-nucleotidase, ecto (CD73) |
| Storage Conditions | Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | WELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAY |
| Form | Liquid |
| Quality control testing | SDS-PAGE under reducing condition |
| Storage Buffer | In 20 mM Tris, 120 mM NaCl, pH 7.5 (20% glycerol, 4 mM CaCl<sub>2</sub>). |
| Gene ID | 4907 |
Más información
Human NT5E (P21589, 27 a.a. - 547 a.a.) partial recombinant protein with His tag at C-terminus expressed in Expi293 cells.