Ver mas grande
Mouse Mif (P34884, 1 a.a. - 115 a.a.) partial recombinant protein expressed in iEscherichia coli/i.
AB-P7630
Producto nuevo
Mif (Mouse) Recombinant Protein
Comprando este producto generará 51 Biopuntos. Su cesta contiene un total 51 Biopuntos puede ser convertido en un Biobonos Descuento 204.00EUR.
Hoja técnica
| Size | 1 mg |
| Gene Name | Mif |
| Gene Alias | GIF|Glif|MGC107654 |
| Gene Description | macrophage migration inhibitory factor |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/mL |
| Gene ID | 17319 |
Más información
Mouse Mif (P34884, 1 a.a. - 115 a.a.) partial recombinant protein expressed in Escherichia coli.