Ver mas grande
TGFB2 (Human) Recombinant Protein
AB-P7579
Producto nuevo
TGFB2 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | TGFB2 |
| Gene Alias | MGC116892|TGF-beta2 |
| Gene Description | transforming growth factor, beta 2 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 7042 |
Más información
Human TGFB2 (P61812, 303 a.a. - 414 a.a.) partial recombinant protein expressed in Human cells.