Ver mas grande
Human CD276 (Q5ZPR3-2, 29 a.a. - 245 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cell.
AB-P7576
Producto nuevo
CD276 (Human) Recombinant Protein
Comprando este producto generará 22 Biopuntos. Su cesta contiene un total 22 Biopuntos puede ser convertido en un Biobonos Descuento 88.00EUR.
Hoja técnica
| Size | 1 mg |
| Gene Name | CD276 |
| Gene Alias | B7-H3|B7H3 |
| Gene Description | CD276 molecule |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 80381 |
Más información
Human CD276 (Q5ZPR3-2, 29 a.a. - 245 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cell.