Ver mas grande
CD47 (Human) Recombinant Protein
AB-P7570
Producto nuevo
CD47 (Human) Recombinant Protein
Comprando este producto generará 26 Biopuntos. Su cesta contiene un total 26 Biopuntos puede ser convertido en un Biobonos Descuento 104.00EUR.
Hoja técnica
| Size | 1 mg |
| Gene Name | CD47 |
| Gene Alias | IAP|MER6|OA3 |
| Gene Description | CD47 molecule |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 961 |
Más información
Human CD47 (Q9BQ51, 19 a.a. - 139 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cell.