Ver mas grande
Tnfrsf4 (Mouse) Recombinant Protein
AB-P7557
Producto nuevo
Tnfrsf4 (Mouse) Recombinant Protein
Comprando este producto generará 22 Biopuntos. Su cesta contiene un total 22 Biopuntos puede ser convertido en un Biobonos Descuento 88.00EUR.
Hoja técnica
| Size | 1 mg |
| Gene Name | Tnfrsf4 |
| Gene Alias | ACT35|CD134|Ly-70|Ox40|TXGP1L|Txgp1 |
| Gene Description | tumor necrosis factor receptor superfamily, member 4 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 22163 |
Más información
Mouse Tnfrsf4 (P47741, 20 a.a. - 211 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK294 cell.