Ver mas grande
Human CTLA4 (P16410, 37 a.a. - 162 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in CHO cell.
AB-P7539
Producto nuevo
CTLA4 (Human) Recombinant Protein
Comprando este producto generará 11 Biopuntos. Su cesta contiene un total 11 Biopuntos puede ser convertido en un Biobonos Descuento 44.00EUR.
Hoja técnica
| Size | 1 mg |
| Gene Name | CTLA4 |
| Gene Alias | CD152|CELIAC3|CTLA-4|GSE|IDDM12 |
| Gene Description | cytotoxic T-lymphocyte-associated protein 4 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 1493 |
Más información
Human CTLA4 (P16410, 37 a.a. - 162 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in CHO cell.