CTSB (Human) Recombinant Protein Ver mas grande

CTSB (Human) Recombinant Protein

AB-P7514

Producto nuevo

CTSB (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name CTSB
Gene Alias APPS|CPSB
Gene Description cathepsin B
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTG
Form Liquid
Storage Buffer In 25 mM Tris-HCl buffer, 150 mM NaCl, pH 8.0 (20% glycerol)
Gene ID 1508

Más información

Human CTSB (P07858, 18 a.a. - 339 a.a.) partial recombinant protein with His tag at C-teminus expressed in CHO cell.

Consulta sobre un producto

CTSB (Human) Recombinant Protein

CTSB (Human) Recombinant Protein