Ver mas grande
Human CXCL1 (P09341, 35 a.a. - 107 a.a.) partial recombinant protein expressed in iEscherichia coli/i.
AB-P7498
Producto nuevo
CXCL1 (Human) Recombinant Protein
Comprando este producto generará 1 Biopunto. Su cesta contiene un total 1 Biopunto puede ser convertido en un Biobonos Descuento 4.00EUR.
Hoja técnica
| Size | 5 ug |
| Gene Name | CXCL1 |
| Gene Alias | FSP|GRO1|GROa|MGSA|MGSA-a|NAP-3|SCYB1 |
| Gene Description | chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/mL |
| Gene ID | 2919 |
Más información
Human CXCL1 (P09341, 35 a.a. - 107 a.a.) partial recombinant protein expressed in Escherichia coli.