Ver mas grande
Csf1 (Mouse) Recombinant Protein
AB-P7477
Producto nuevo
Csf1 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | Csf1 |
| Gene Alias | C87615|CSF-1|Csfm|M-CSF|op |
| Gene Description | colony stimulating factor 1 (macrophage) |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from 50 mM Tris, 150 mM NaCl, pH 8.0. Reconstitute the lyophilized powder in ddH<sub>2</sub>O up to 100 ug/mL. |
| Gene ID | 12977 |
Más información
Mouse Csf1 (P07141, 33 a.a. - 187 a.a.) partial recombinant protein with an N-terminal Met expressed in Escherichia coli.