AB-P7453
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
No hay Biopuntos para este producto
Size | 10 ug |
Gene Name | Flt3l |
Gene Alias | Flt3lg|Ly72L |
Gene Description | FMS-like tyrosine kinase 3 ligand |
Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | Func,SDS-PAGE |
Immunogen Prot. Seq | GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPR |
Form | Lyophilized |
Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Mouse |
Storage Buffer | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O or PBS up to 100 ug/mL. |
Gene ID | 14256 |