Ver mas grande
Flt3l (Mouse) Recombinant Protein
AB-P7453
Producto nuevo
Flt3l (Mouse) Recombinant Protein
No hay Biopuntos para este producto
Hoja técnica
| Size | 10 ug |
| Gene Name | Flt3l |
| Gene Alias | Flt3lg|Ly72L |
| Gene Description | FMS-like tyrosine kinase 3 ligand |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPR |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O or PBS up to 100 ug/mL. |
| Gene ID | 14256 |
Más información
Mouse Flt3l (P49772, 27 a.a. - 188 a.a.) partial recombinant protein with His tag expressed in CHO cells.