Ver mas grande
Rat Fgf2 (P13109, 10 a.a. - 154 a.a.) partial recombinant protein with an N-terminal Gly expressed in iEscherichia coli/i.
AB-P7432
Producto nuevo
Fgf2 (Rat) Recombinant Protein
Comprando este producto generará 1 Biopunto. Su cesta contiene un total 1 Biopunto puede ser convertido en un Biobonos Descuento 4.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | Fgf2 |
| Gene Alias | Fgf-2|bFGF |
| Gene Description | fibroblast growth factor 2 |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Rat |
| Storage Buffer | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O up to 100 ug/mL. |
| Gene ID | 54250 |
Más información
Rat Fgf2 (P13109, 10 a.a. - 154 a.a.) partial recombinant protein with an N-terminal Gly expressed in Escherichia coli.