Ver mas grande
Human IGF2 ( P01344-1, 25 a.a. - 91 a.a.) partial recombinant protein expressed in iEscherichia coli/i.
AB-P7406
Producto nuevo
IGF2 (Human) Recombinant Protein
Comprando este producto generará 1 Biopunto. Su cesta contiene un total 1 Biopunto puede ser convertido en un Biobonos Descuento 4.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | IGF2 |
| Gene Alias | C11orf43|FLJ22066|FLJ44734|INSIGF|pp9974 |
| Gene Description | insulin-like growth factor 2 (somatomedin A) |
| Storage Conditions | Store at 4ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O up to 100 ug/mL. |
| Gene ID | 3481 |
Más información
Human IGF2 ( P01344-1, 25 a.a. - 91 a.a.) partial recombinant protein expressed in Escherichia coli.