Ver mas grande
Mouse Il19 (Q8CJ70, 25 a.a. - 179 a.a.) partial recombinant protein expressed in iEscherichia coli/i.
AB-P7369
Producto nuevo
Il19 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | Il19 |
| Gene Alias | - |
| Gene Description | interleukin 19 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from 50 mM acetic acid. Reconstitute the lyophilized powder in 50 mM acetic acid up to 50 ug/mL. |
| Gene ID | 329244 |
Más información
Mouse Il19 (Q8CJ70, 25 a.a. - 179 a.a.) partial recombinant protein expressed in Escherichia coli.