Ver mas grande
Shh (Mouse) Recombinant Protein
AB-P7307
Producto nuevo
Shh (Mouse) Recombinant Protein
Comprando este producto generará 1 Biopunto. Su cesta contiene un total 1 Biopunto puede ser convertido en un Biobonos Descuento 4.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | Shh |
| Gene Alias | 9530036O11Rik|Dsh|Hhg1|Hx|Hxl3|M100081 |
| Gene Description | sonic hedgehog |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | LVLGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPG1VKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O up to 100 ug/mL. |
| Gene ID | 20423 |
Más información
Mouse Shh (Q62226, 25 a.a. - 198 a.a.) C25IVI mutant partial recombinant protein expressed in Escherichia coli.