Exendin-4 (Reptilia) Recombinant Protein Ver mas grande

Exendin-4 (Reptilia) Recombinant Protein

AB-P7195

Producto nuevo

Exendin-4 (Reptilia) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml

Más información

Reptilia Exendin-4 (P26349, 48 a.a. - 86 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Exendin-4 (Reptilia) Recombinant Protein

Exendin-4 (Reptilia) Recombinant Protein