TNFRSF17 (Human) Recombinant Protein Ver mas grande

Human TNFRSF17 (Q02223, 5 a.a. - 54 a.a.) partial recombinant protein expressed in iEscherichia coli/i.

AB-P7164

Producto nuevo

TNFRSF17 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 20 ug
Gene Name TNFRSF17
Gene Alias BCM|BCMA|CD269
Gene Description tumor necrosis factor receptor superfamily, member 17
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 608

Más información

Human TNFRSF17 (Q02223, 5 a.a. - 54 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Human TNFRSF17 (Q02223, 5 a.a. - 54 a.a.) partial recombinant protein expressed in iEscherichia coli/i.

Human TNFRSF17 (Q02223, 5 a.a. - 54 a.a.) partial recombinant protein expressed in iEscherichia coli/i.