Ver mas grande
SERPINF1 (Human) Recombinant Protein
AB-P7160
Producto nuevo
SERPINF1 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | SERPINF1 |
| Gene Alias | EPC-1|PEDF|PIG35 |
| Gene Description | serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSI |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml |
| Gene ID | 5176 |
Más información
Human SERPINF1 (P36955, 20 a.a. - 418 a.a.) partial recombinant protein expressed in Escherichia coli.