Ver mas grande
Mouse VGFA (Q00731-2, 27 a.a. - 190 a.a.) partial recombinant protein expressed in iPichia pastoris/i.
AB-P7146
Producto nuevo
VEGFA (Mouse) Recombinant Protein
Comprando este producto generará 27 Biopuntos. Su cesta contiene un total 27 Biopuntos puede ser convertido en un Biobonos Descuento 108.00EUR.
Hoja técnica
| Size | 1 mg |
| Gene Name | Vegfa |
| Gene Alias | Vegf|Vegf-a|Vegf120|Vegf164|Vegf188|Vpf |
| Gene Description | vascular endothelial growth factor A |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKN |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/ml |
| Gene ID | 22339 |
Más información
Mouse VGFA (Q00731-2, 27 a.a. - 190 a.a.) partial recombinant protein expressed in Pichia pastoris.