Ver mas grande
Human IL11 (P202809-1, 22 a.a. - 199 a.a.) partial recombinant protein expressed in CHO cell.
AB-P7097
Producto nuevo
IL11 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 5 ug |
| Gene Name | IL11 |
| Gene Alias | AGIF|IL-11 |
| Gene Description | interleukin 11 |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSL |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from PBS up to 100 ug/ml |
| Gene ID | 3589 |
Más información
Human IL11 (P202809-1, 22 a.a. - 199 a.a.) partial recombinant protein expressed in CHO cell.