Ver mas grande
S (SARS-CoV-2 Beta Variant) RBD Recombinant Protein
AB-P6703
Producto nuevo
S (SARS-CoV-2 Beta Variant) RBD Recombinant Protein
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Hoja técnica
| Size | 50 ug |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA,SDS-PAGE |
| Immunogen Prot. Seq | RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
| Form | Liquid |
| Recomended Dilution | ELISA<br>SDS-PAGE<br>Western Blot<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | SARS-CoV-2 |
| Quality control testing | SDS-PAGE |
| Storage Buffer | In PBS. |
Más información
SARS-CoV-2 Beta Variant S RBD (GISAID No. EPI_ISL_736980, 319 a.a. - 541 a.a.) K417N, E484K, N501Y mutant recombinant protein with 6xHis tag at C-terminus expressed in HEK293 cells.