Ver mas grande
Csf1 (Rat) Recombinant Protein
AB-P6455
Producto nuevo
Csf1 (Rat) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | Csf1 |
| Gene Alias | - |
| Gene Description | colony stimulating factor 1 (macrophage) |
| Storage Conditions | Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,Func |
| Immunogen Prot. Seq | MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP |
| Form | Lyophilized |
| Quality control testing | Reducing and Non-Reducing SDS PAGE |
| Storage Buffer | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5. |
| Gene ID | 78965 |
Más información
Rat Csf1 (Q8JZQ0) recombinant protein expressed in E.Coli.