Ver mas grande
Human TNFRSF13B (O14836) recombinant protein expressed in iE. Coli/i.
AB-P6406
Producto nuevo
TNFRSF13B (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | TNFRSF13B |
| Gene Alias | CD267|CVID|FLJ39942|MGC133214|MGC39952|TACI|TNFRSF14B |
| Gene Description | tumor necrosis factor receptor superfamily, member 13B |
| Storage Conditions | Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,Func |
| Immunogen Prot. Seq | SGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQV |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from PBS, pH 7.2. |
| Gene ID | 23495 |
Más información
Human TNFRSF13B (O14836) recombinant protein expressed in E. Coli.