Ver mas grande
INHBB (Human) Recombinant Protein
AB-P6324
Producto nuevo
INHBB (Human) Recombinant Protein
Comprando este producto generará 9 Biopuntos. Su cesta contiene un total 9 Biopuntos puede ser convertido en un Biobonos Descuento 36.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | INHBB |
| Gene Alias | MGC157939 |
| Gene Description | inhibin, beta B |
| Storage Conditions | Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB |
| Immunogen Prot. Seq | GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from PBS, pH 7.2. |
| Gene ID | 3625 |
Más información
Human INHBB (P09529) recombinant protein expressed in CHO cells.