Ver mas grande
Human DEFB103A (P81534) recombinant protein expressed in iE.Coli/i.
AB-P6225
Producto nuevo
DEFB103A (Human) Recombinant Protein
Comprando este producto generará 7 Biopuntos. Su cesta contiene un total 7 Biopuntos puede ser convertido en un Biobonos Descuento 28.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | DEFB103A |
| Gene Alias | BD-3 |
| Gene Description | defensin, beta 103A |
| Storage Conditions | Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile 10 mM acetic acid at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB |
| Immunogen Prot. Seq | GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK |
| Form | Lyophilized |
| Quality control testing | Reducing and Non-Reducing SDS PAGE |
| Storage Buffer | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA). |
| Gene ID | 414325 |
Más información
Human DEFB103A (P81534) recombinant protein expressed in E.Coli.