Ver mas grande
Oit1 (Mouse) Recombinant protein
AB-P5908
Producto nuevo
Oit1 (Mouse) Recombinant protein
Comprando este producto generará 7 Biopuntos. Su cesta contiene un total 7 Biopuntos puede ser convertido en un Biobonos Descuento 28.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | Oit1 |
| Gene Alias | 2310076N21Rik|AV067083|EF-7|Fam3d|MGC37550 |
| Gene Description | oncoprotein induced transcript 1 |
| Storage Conditions | Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 2.3 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | GSYTSFSRKTIRLPRWLGITPKDIQTPKSKCGLSKICPNNAFKISSGAANVVGPSMCFEDEIIMSPVRNNVGRGLNVALVNGSTGQVMKKDSFDMYSGDPQLLLNTEIPDSTLVLVASYDDPGTKMNDKIKTLFSNLGSSYAKQLGFRDSWVFVGAKDLKSKSPYEQKNNPETNKYDGWPELLELEGCVPRKVMAAAHHHHHH |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Quality control testing | NuPAGE Stained with Coomassie Blue |
| Storage Buffer | In PBS without preservative |
| Gene ID | 18300 |
Más información
Mouse Oit1 (NP_666162, 26 a.a. - 223 a.a.) partial recombinant protein with C-terminal hexahistidine tag expressed in HEK293EBNA1 cells.