Ver mas grande
Human TK2 (NP_004605, 34 a.a. - 265 a.a.) partial recombinant protein with His tag expressed in iEscherichia coli/i.
AB-P5855
Producto nuevo
TK2 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | TK2 |
| Gene Alias | - |
| Gene Description | thymidine kinase 2, mitochondrial |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMVQRRAWPPDKEQEKEKKSVICVEGNIASGKTTCLEFFSNATDVEVLTEPVSKWRNVRGHNPLGLMYHDASRWGLTLQTYVQLTMLDRHTRPQVSSVRLMERSIHSARYIFVENLYRSGKMPEVDYVVLSEWFDWILRNMDVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRDRILTPENRKH |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed. |
| Storage Buffer | In 20 mM Tris-HCl buffer, 200 mM NaCl, pH 8.0 (30% glycerol, 2 mM DTT). |
| Gene ID | 7084 |
Más información
Human TK2 (NP_004605, 34 a.a. - 265 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.