Ver mas grande
Human CRYGN (NP_653328, 1 a.a. - 182 a.a.) full-length recombinant protein with His tag expressed in iEscherichia coli/i.
AB-P5851
Producto nuevo
CRYGN (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | CRYGN |
| Gene Alias | MGC119042|MGC119043|MGC119044|MGC119045 |
| Gene Description | crystallin, gamma N |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMAQRSGKITLYEGKHFTGQKLEVFGDCDNFQDRGFMNRVNSIHVESGAWVCFNHPDFRGQQFILEHGDYPDFFRWNSHSDHMGSCRPVGMHGEHFRLEIFEGCNFTGQCLEFLEDSPFLQSRGWVKNCVNTIKVYGDGAAWSPRSFGAEDFQLSSSLQSDQGPEEATTKPATTQPPFLTANL |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed. |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH 8.0 (0.4 M Urea, 10% glycerol). |
| Gene ID | 155051 |
Más información
Human CRYGN (NP_653328, 1 a.a. - 182 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.