Ver mas grande
Human VTA1 (NP_057569, 1 a.a. - 307 a.a. ) full-length recombinant protein with His tag expressed in iEscherichia coli/i.
AB-P5849
Producto nuevo
VTA1 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | VTA1 |
| Gene Alias | C6orf55|DRG-1|DRG1|FLJ27228|HSPC228|LIP5|My012|SBP1 |
| Gene Description | Vps20-associated 1 homolog (S. cerevisiae) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYTGIQIPPGAHAPANTPAEVPHS |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed. |
| Storage Buffer | In 20 mM Tris-HCl buffer, 200 mM NaCl, pH 8.0 (2 mM DTT, 10% glycerol). |
| Gene ID | 51534 |
Más información
Human VTA1 (NP_057569, 1 a.a. - 307 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.