Ver mas grande
Human WNK3 (NP_065973.2, 1 a.a. - 434 a.a.) partial recombinant protein with GST tag at N-terminal expressed in baculovirus infe
AB-P5664
Producto nuevo
WNK3 (Human) Recombinant Protein
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 5 ug |
| Gene Name | WNK3 |
| Gene Alias | KIAA1566|PRKWNK3 |
| Gene Description | WNK lysine deficient protein kinase 3 |
| Storage Conditions | Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MAPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGAMATDSGDPASTEDSEKPDGISFEN |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 1 ug protein in SDS-PAGE |
| Storage Buffer | In 50 mM Tris-HCl, 150 mM NaCl, pH 7.5 (0.05% Brij35, 1 mM DTT, 10% glycerol). |
| Gene ID | 65267 |
Más información
Human WNK3 (NP_065973.2, 1 a.a. - 434 a.a.) partial recombinant protein with GST tag at N-terminal expressed in baculovirus infected Sf21 cells.