Ver mas grande
HSPB2 (Human) Recombinant Protein
AB-P5398
Producto nuevo
HSPB2 (Human) Recombinant Protein
No hay Biopuntos para este producto
Hoja técnica
| Size | 100 ug |
| Gene Name | HSPB2 |
| Gene Alias | HSP27|Hs.78846|LOH11CR1K|MGC133245|MKBP |
| Gene Description | heat shock 27kDa protein 2 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.5 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH 8.0 (20% glycerol, 1 mM DTT). |
| Gene ID | 3316 |
Más información
Human HSPB2 (NP_001532, 1 a.a. - 182 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.