Ver mas grande
Human PAK4 kinase domain (O96013, 300 a.a. - 591 a.a.) partial recombinant protein expressed in iEscherichia coli/i.
AB-P5384
Producto nuevo
PAK4 (Human) Recombinant Protein
Comprando este producto generará 7 Biopuntos. Su cesta contiene un total 7 Biopuntos puede ser convertido en un Biobonos Descuento 28.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | PAK4 |
| Gene Alias | - |
| Gene Description | p21 protein (Cdc42/Rac)-activated kinase 4 |
| Storage Conditions | Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/ml |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | <u><b>GPHM</b></u>SHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRK<u><b>S</u></b>LVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLK |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 7 ug protein in SDS-PAGE |
| Storage Buffer | In 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT. |
| Gene ID | 10298 |
Más información
Human PAK4 kinase domain (O96013, 300 a.a. - 591 a.a.) partial recombinant protein expressed in Escherichia coli.